• Buy cheap Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C product
    Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C Specifications: Model HWAC20 Cooling capcity kW 50 Power supply 380V/3PH/50Hz Cooling power input kW 15.1 ... more
    Brand Name:Head-Power
    Model Number:HWAC20
    Place of Origin:China

    Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C

    Lingdo Industrial Limited
  • Buy cheap ACVR2B 1mg Polypeptide Hormone Myostatin Inhibitor ACE 031 For Building Musclea product
    About ACE-031 Description: 40.5 kDa protein containing 368 amino acid residues of the ActRIIb-hFc recombinant protein. MDAMKRGLCCVLLLCGAVFVSPGASGRGEAETRECIYYNANWELERTN QSGLERCEGEQD... more
    Brand Name:HKYC
    Model Number:ACE-031
    Place of Origin:China

    ACVR2B 1mg Polypeptide Hormone Myostatin Inhibitor ACE 031 For Building Musclea

  • Buy cheap Hot Cold Test Programmable Walk In Environmental Test Chambers For Airplane / Aircraft product
    Hot cold test programmable walk in climate test equipment 1.Introduction & Application: Temperature humidity controlled walk in environmental chamber/climatic test room can ... more
    Brand Name:KOMEG
    Model Number:KMHW-4
    Place of Origin:China,Dongguan

    Hot Cold Test Programmable Walk In Environmental Test Chambers For Airplane / Aircraft

  • Buy cheap Hafnium Carbide Powder, HfC powder product
    Hello,This is Mia, now Please let me introduce HfC to you! You can directly got more details from mia@cslfjs.cn ~ HfC basic Specification: 1) chemical stable, excellent high... more
    Brand Name:LFJS-HfC
    Model Number:LF-HfC
    Place of Origin:Asia, China, Hunan Changsha

    Hafnium Carbide Powder, HfC powder

  • Buy cheap Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C product
    Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C Specifications: Model HWAC20 Cooling capcity kW 50 Power supply 380V/3PH/50Hz Cooling power input kW 15.1 ... more
    Brand Name:Head-Power
    Model Number:HWAC
    Place of Origin:China

    Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C

    Lingdo Industrial Limited
  • Buy cheap ACE 031 ActRIIb-hFc product
    ACE 031 Protein for bodybuiding ACE-031 profile: ACE-031 is an investigational protein which increases myocyte activity by inhibiting molecules that bind to and signal through a ... more
    Brand Name:powerfulbiotech
    Place of Origin:Shanghai

    ACE 031 ActRIIb-hFc

    PHTD peptide
  • Buy cheap High density Hafnium carbide powder,High purity hafnium carbide,low hafnium carbide price product
    quality enhance the value, service to win the trust Hafnium carbide powder Product introduced: Hafnium carbide,Chemical formula HfC ,Molecular weight 190.5,Carbon content 6.30%.The ... more
    Brand Name:hongtech
    Model Number:BAOJIHT686789885
    Place of Origin:BAOJI

    High density Hafnium carbide powder,High purity hafnium carbide,low hafnium carbide price

  • Buy cheap Nano Carbide Powder SiC VC Cr3C2 WC B4C ZrC NbC Mo2C TiC TaC HfC Etc product
    Quick Detail: Nano carbide powder SiC, VC, Cr3C2, WC, B4C, ZrC, NbC, Mo2C, TiC, TaC, HfC etc. Grade: Nano silicon carbide powder (SiC) Nano vanadium carbide powder (VC) Nano ... more
    Brand Name:Lambut
    Model Number:10-100nm
    Place of Origin:China

    Nano Carbide Powder SiC VC Cr3C2 WC B4C ZrC NbC Mo2C TiC TaC HfC Etc

  • Buy cheap Injectable Growth Drostanolone Freeze Powder 2mgial ACE -031 product
    Injectable Growth Drostanolone Freeze Powder 2mgial ACE -031 Quick Details: ACVR2B/ACE031/ACE-031/ACE 031 CAS:616204-22-9 Vials/boxes or lyophilized powder Shipped by reliable ... more
    Brand Name:Holybiological
    Model Number:616204-22-9
    Place of Origin:China

    Injectable Growth Drostanolone Freeze Powder 2mgial ACE -031

  • Buy cheap Rubidium carbonate, Rb2CO3, CAS ID : 584-09-8, 99.9% purity, white powder product
    Rubidium carbonate, Rb2CO3, CAS ID : 584-09-8 Rubidium carbonate, Rb2CO3 material from TYR as following: High pure Rubidium carbonate, Rb2CO3 powder: purity: 99.5%, 99.9%, powder ... more
    Brand Name:TYR
    Model Number:Rb2CO3
    Place of Origin:CHINA

    Rubidium carbonate, Rb2CO3, CAS ID : 584-09-8, 99.9% purity, white powder

  • Buy cheap Hfc Hydralic Boom Lift Work Platform product
    Packing: waxedModel NO.: JDFStandard: ISO2001Productivity: 5000 pcs/yearUnit Price/Payment: T/TTrademark: dongfengOrigin: ChinaMin. Order: 1 SETTransportation: BULK SHIP OR RORO ... more
    Place of Origin:Hubei, china
    Emission Standard:Manual
    Dimensions (L x W x H) (mm):Diesel

    Hfc Hydralic Boom Lift Work Platform

  • Buy cheap HIGH MALTOSE POWDER product
    Characteristics High Maltose Powder is a maltose monohydrate, a carbohydrate sweetener and bulking agent. High Maltose possesses fine anti-crystallization since it contains ... more


  • Buy cheap File Cabinet Series HFC-F001 product
    Size:H900*W850*D390 Thickness:0.5 0.6mm Static Powder Sprayed We Provide All Kinds Ssteel Office Furnitures, We Also Provide OEM, ODM Service For You. more
    Categories:Filing & Storage Cabinets
    Telephone:+86-379-63329195, 63329196, 63329197, 63329198

    File Cabinet Series HFC-F001

  • Buy cheap High density Hafnium carbide powder,High purity hafnium carbide,low hafnium carbide price product
    quality enhance the value, service to win the trust Hafnium carbide powder Product introduced: Hafnium carbide,Chemical formula HfC ,Molecular weight 190.5,Carbon content 6.30%.The ... more
    Brand Name:ABC
    Model Number:BAOJIHT686789885
    Place of Origin:BAOJI

    High density Hafnium carbide powder,High purity hafnium carbide,low hafnium carbide price

  • Buy cheap Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C product
    Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C Specifications: Model HWAC20 Cooling capcity kW 50 Power supply 380V/3PH/50Hz Cooling power input kW 15.1 ... more
    Brand Name:Head-Power
    Model Number:HWAC
    Place of Origin:China

    Modular Air Cooled Packaged Chiller With Hydraulic Module , HFC-407C

  • Buy cheap E-2000 1550nm CATV Optical Transmitter Laser OMI For SMATV HFC product
    E-2000 1550nm CATV Optical Transmitter Laser OMI For SMATV HFC Network Hot Sale 47-862MHz 1550±5nm Internal Modulation Optical Transmitter 1550 with 2 Output Optical Power ≥6DB, ... more
    Brand Name:SOFTEL.OEM
    Model Number:ST1550I-2-6
    Place of Origin:Zhejiang Province, China

    E-2000 1550nm CATV Optical Transmitter Laser OMI For SMATV HFC

  • Buy cheap Fructose Powder,crystalline Fructose product
    CHEMaster International Inc. specializes in research and and manufacture of HIGH Fructose Corn syrup (HFCS), Fructose Syrup,high Fructose Syrup (HFS),fructose powder,crystalline ... more

    Fructose Powder,crystalline Fructose

  • Buy cheap fructose powder,  crystalline fructose,  HIGH Fructose Corn syrup,  HFCS,  Fructose Syrup,  high Fructose Syrup,  HFS,  . product
    CHEMaster International Inc. specializes in research and and manufacture of HIGH Fructose Corn syrup ( HFCS) , Fructose Syrup, high Fructose Syrup ( HFS) , fructose powder, ... more
    Place of Origin:china
    Sample Price:Depending on the market supply and demand

    fructose powder, crystalline fructose, HIGH Fructose Corn syrup, HFCS, Fructose Syrup, high Fructose Syrup, HFS, .

  • Buy cheap Crystalline Fructose, Frctose, Fructose Powder product
    Crystalline Fructose CAS NO. 57-48-7 Molecular Formula: C6H12O6 Purity 99% Crystalline Fructose CAS NO. 57-48-7 Molecular Formula: C6H12O6 Crystalline Fructose is a processed ... more
    Brand Name:Globalchem/XIWANG/LUZHOU
    Place of Origin:China
    FEMA No.:235-86-9

    Crystalline Fructose, Frctose, Fructose Powder

  • Buy cheap Fructose powder,Crystalline Fructose, Fructosa cristalina, Fructose, levulose product
    TaoSign Corporation specializes in research and and manufacture of Mannitol,manitol,Sorbitol, sorbitol usp, Sorbitol powder, Liquid Sorbitol, sorbitol Syrup, Fructose powder... more
    Place of Origin:china
    Category:Milk Powder
    Sample Price:negotiable

    Fructose powder,Crystalline Fructose, Fructosa cristalina, Fructose, levulose

    TaoSign Corporation
Tell “hfc powder” Suppliers Your Requirement
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0