• Quality  wholesale
    ...Injection Hormone Peptide Igf lr3 CAS 946870-92-4 for Hospital for Muscle Growth 1, Basic Information Model NO.: CAS 946870-92-4 ... more
    Brand Name:Gear Steroids
    Model Number:946870-92-4
    Place of Origin:CHINA

    Injection Hormone Human Growth Peptides Igf lr3 CAS 946870-92-4 for Hospital

  • Quality  wholesale
    ...Injectable Human Growth Hormone Peptide IGF lR3-1 1000mcg/vial Long-R3 for Fatness Basic information: Product Name: IGTROPIN /IGF-1 lr3 Manufacturer: GenSci Laboratories, China. Substance: Insuline-like Growth Factor Package: 1000mcg/vial * 10vials/kit The... more
    Brand Name:Bodybiological
    Place of Origin:Hubei, China
    Certification:ISO9001, SGS

    Injectable Human Growth Hormone Peptide IGF LR3-1 1000mcg / Vial Long-R3 Igtropin

  • Quality  wholesale
    ... Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4 IGF --- Insulin-Like Growth Factors What is IGF1-LR3 ? IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF... more
    Brand Name:Hongkong Blue Universal
    Model Number:946870-92-4
    Place of Origin:China

    Human Peptides IGF Lr3 For Greatly Boosts Muscle Mass 946870-92-4

  • Quality  wholesale
    ...IGF-LR3 Anti-aging Fat Loss IGF LR3 HGH Growth Hormone Supplements Wrinkle Remover for Women IGF-1Lr3 1mg/vial,10vials/kit 0.1mg/vial,10vials/kit 1. Payment & Shipping Terms: Packaging Details: Discreet ... more
    Brand Name:YC
    Model Number:CAS: 125-69-9
    Place of Origin:China

    IGF-LR3 1mg/vial Anti-aging Fat Loss IGF LR3 Peptides HGH Growth Hormone Supplements Wrinkle Remover for Women

  • Quality  wholesale
    ...IGF LR3 -1Growth Hormone Peptide Igf-1Lr3 Igf Lr CAS 946870-92-4 For Lean Muscles / Recovery IGF LR3 Description IGF-1 is basically a polypeptide hormone that has the same some of the same molecular properties as insulin. IGF dose actually... more
    Brand Name:IGF LR3 -1
    Model Number:IGF LR3 -1
    Place of Origin:China

    IGF LR3 -1Growth Hormone Peptide Igf-1Lr3 Igf Lr CAS 946870-92-4 For Lean Muscles / Recovery

    JCJ Logis Co.,ltd
    [Hubei,China]
  • Quality  wholesale
    ...99% Purity IGF-1 lr3 the Anabolic Powerhouse for Bodybuilding Email: ling@chembj.com Skype: ling@chembj.com Whatsapp: 0086 181 0845 9329 What is IGF1-LR3 IGF-1 is basically a polypeptide hormone that has the... more
    Brand Name:Muscle Building
    Model Number:946870-92-4
    Place of Origin:China

    GMP Lab Supply High Quality Igf-1 lr3 peptide IGF-1 LR3 for Muscle Growth

  • Quality  wholesale
    ...Human Growth Hormone Peptides IGF-1 LR3 0.1 mg/vial CAS 946870-92-4 For Good Body Shape Abstract IGF-1Lr3 is basically a polypeptide hormone that has the same some of the same molecular properties ... more
    Brand Name:YUANYANG
    Model Number:946870-92-4
    Place of Origin:China

    Human Growth Hormone Peptides IGF-1 LR3 0.1 mg/vial CAS 946870-92-4 For Good Body Shape

  • Quality  wholesale
    ...Muscle Gain Peptides IGF 1 LR3 Growth Hormone Peptides Muscle Enhancing Steroid Description: IGF1 LR3 is known for being a growth hormone. It has plenty of growth promoting effects and it ... more
    Brand Name:Shanghai Stero
    Model Number:IGF
    Place of Origin:China

    Muscle Gain Peptides IGF 1 LR3 Growth Hormone Peptides Muscle Enhancing Steroid

    Shanghai Stero R&D Co,. Ltd
    [Shanghai,China]
  • Quality  wholesale
    ...HGH Peptides IGF 0.1mg / vial Recombinant Human LR3 IGF-I Protein High Purity Is determined by SDS-PAGE (>95%) and reverse phase HPLC (>90%). This is the purest commercially available recombinant human LR3 IGF-I (Figure 1). The high... more
    Brand Name:ChineseHormone
    Model Number:CAS 946870-92-4
    Place of Origin:China

    HGH Peptides IGF 0.1mg / vial Recombinant Human LR3 IGF-I Protein

  • Quality  wholesale
    ...Hormone Peptides IGF -1 DES 1mg / vial Basic Info. Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA Molar Mass: 7,372 Da Synonyms: IGF-1Des(1-3), Des1-3, Des 1-3, Des (1-3) Compound: Thr-Leu-Cys-Gly-Ala. Purity: 99.21% IGF-1DES... more
    Brand Name:Biopro
    Model Number:GHP-37
    Place of Origin:China

    GMP Body Protection Compound Muscle Growth Hormone Peptides IGF -1 DES 1mg / vial

    Biopro Chemicals Co., Ltd.
    [Shanghai,China]
  • Quality  wholesale
    ...Human Growth Hormone Peptide IGF-1 LR3 1mg For Natural Muscle Growth Quick detial Product name: IGF-1Lr3 Appearance:White lyophilized powder Specification: 1mg/vial Packing:10vials per kits Catagory: Human Growth Hormone Peptide There was... more
    Brand Name:Pharmlab
    Model Number:IGF-1 LR3
    Place of Origin:China

    Human Growth Hormone Peptide IGF-1 LR3 1mg , Natural Muscle Growth Hormone Peptide

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Quality  wholesale
    ...White Powder Research Peptides Igf-1 Lr3 Bodybuilding IGF-1 LR3 by Lab For Adult With GMP IGF-1 LR3 Quick Detail: Product name:IGF-1Lr3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool Place ... more
    Brand Name:Muscle
    Model Number:CAS: 946870-92-4
    Place of Origin:China

    1mg / Vial Research Chemicals Peptides , IGF 1 LR3 Peptides For Adult CAS 946870-92-4

  • Quality  wholesale
    ...HGH Growth Hormone IGF LR3 Peptides 1mg / vial 0.1mg / vial Anti aging Fat Loss Wrinkle Remover Quick Details Product name:IGF-1 LR3 CAS No.:946870-92-4 Purity:.98%min Appearance:White powder Storage:Dry Cool... more
    Brand Name:HKYC
    Model Number:946870-92-4
    Place of Origin:China

    HGH Growth Hormone IGF LR3 Peptides 1mg / vial 0.1mg / vial Anti aging Fat Loss Wrinkle Remover

  • Quality  wholesale
    ...Pharmaceutical grade 99% Injection Hormone Peptide IGF-1 LR3 CAS 946870-92-4 for Muscle Growth Basic Information Model NO.: CAS 946870-92-4 Customized: Customized ... more
    Brand Name:Nanjian
    Model Number:946870-92-4
    Place of Origin:China

    99% Injection Hormone Peptide IGF-1 LR3 CAS 946870-92-4 for Muscle Growth

  • Quality  wholesale
    ...Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1 Basic Info. Product name: IGF-1Lr3 Synonyms: R3 IGF1, R3 IGF-1, R3IGF1, R3IGF-1, LONG IGF1, LONG IGF-1, LONG R3 IGF1, CAS No.: 946870-92... more
    Brand Name:huao
    Model Number:946870-92-4
    Place of Origin:China

    Bodybuilding Human Growth Peptides IGF-1 LR3 Insulin Like Growth Factor LONG R3 IGF-1

  • Quality  wholesale
    ...Amino Acid Peptides IGF-1 LR3 for Increased Biological Activity CAS 946870-92-4 WHAT IS IGF-1 LR3? IGF-1 LR3, also known as Long Arg3 IGF-1, is a recombinant protein analogue of human Insulin-Like Growth Factor-1 that has a molar mass... more
    Brand Name:Skype: rdy705
    Model Number:ycwlb045@yccreate.com
    Place of Origin:China

    Amino Acid Peptides IGF-1 LR3 for Increased Biological Activity CAS 946870-92-4

  • Quality  wholesale
    ...Recombinant IGF 1 LR3 Peptide Steroid Hormones For Muscle Growth Peptides​ Quick Details: IGF LR3 -1 Assay:97% Model:10iu/vial Package:10vial/kit Apperance:White Lyophilized powder. Manufacturer :Biofriend Usage :... more
    Brand Name:BOF
    Model Number:IGF LR3 -1
    Place of Origin:China

    Recombinant IGF 1 LR3 Peptide Steroid Hormones For Muscle Growth Peptides

  • Quality  wholesale
    ... detailed info,please contact me at Email/MSN:alisa-hgh at hotmail.com Commodity Name:IGF-LR3HGH Specification:100mcg/vail,10vails/kit,1000mcg/kit Status:Brand new, expiration date in 3 years... more
    Brand Name:IGF-LR3
    Place of Origin:China
    Packaging Details:Carefully packed into Carton box

    IGF-LR3 HGH

  • Quality  wholesale
    ...Pharmaceutical Grade Peptide Long R3 IGF-1 high-purity Fast Delivery, Gmp Peptides IGF 1 LR3 Name:IGF-1 LR3 Other Names:insulin-like growth factors -1 Formula:C400H625N111O115S9 Molar mass:9117.5 g/mol Brand Name:Kirobiotech ... more
    Brand Name:N/A
    Model Number:IGF-1 LR3
    Place of Origin:China

    Pharmaceutical Grade Peptide Long R3 IGF-1 Muscle Building , Gmp Peptides IGF 1 LR3

  • Quality  wholesale
    ... Peptides IGF -1LR3 For Growth Promoting IGF-1LR3 Basic Info: Product name IGF-1Lr3 CAS No. 946870-92-4 Purity 95% Appearance White powder Storage Dry Cool Place Specification 1mg/vial Introductation : What is IGF1-LR3 IGF... more
    Brand Name:Shucan
    Model Number:221231-10-3
    Place of Origin:China

    Lab Research Human Growth Peptides IGF -1LR3 For Growth Promoting

Tell “peptide igf 1 lr3” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0